Amycolatopsis roodepoortensis: NQK81_40190 Help Entry NQK81_40190       CDS       T08507                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aroo  Amycolatopsis roodepoortensis Pathway aroo00998   Biosynthesis of various antibiotics aroo01100   Metabolic pathways aroo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aroo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQK81_40190    00074 Mycolic acid biosynthesis     NQK81_40190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQK81_40190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UUV30916 LinkDB All DBs Position 8360864..8361127 Genome browser AA seq 87 aa AA seqDB search MGDHRAEVVKVVSETFRLDPAEIESDAPLEELGIDSKGRIRLLSALEIYHDVRIDLDQLD RFTDIGSVAEVLAEALGVKADGSDERR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgggtgatcaccgcgcggaggtcgtgaaggtcgtcagtgagacttttcggcttgatccc gccgaaatcgagtccgacgcgccgctcgaagagctgggtatcgactccaagggacggata agactcctgtcggcgctggagatctaccacgacgtgaggatcgatctggaccagctggac cggttcaccgacatcgggtcggtggccgaggtgctcgcagaggcactcggcgtcaaggcc gacggatccgacgaaaggcgctga

DBGET integrated database retrieval system