Arcobacter roscoffensis: NJU99_01600 Help Entry NJU99_01600       CDS       T09051                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism aros  Arcobacter roscoffensis Pathway aros00361   Chlorocyclohexane and chlorobenzene degradation aros00362   Benzoate degradation aros00623   Toluene degradation aros01100   Metabolic pathways aros01120   Microbial metabolism in diverse environments aros01220   Degradation of aromatic compounds Module aros_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aros00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NJU99_01600    00361 Chlorocyclohexane and chlorobenzene degradation     NJU99_01600    00623 Toluene degradation     NJU99_01600 Enzymes [BR:aros01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      NJU99_01600     1.14.13.244  phenol 2-monooxygenase (NADH)      NJU99_01600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  UTJ06807 LinkDB All DBs Position 319647..319916 Genome browser AA seq 89 aa AA seqDB search MSKVFLALQAVDETRAIIEAIQEDNENVEVEPQPAMVKISAEKKMVINAQTVSDKLGRDW DPQELQLVLISLAGNVDEDYDHFTIYWEN NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaggtatttttagcacttcaagcagtagatgaaacaagagctattattgaagct atacaagaagataatgaaaatgttgaggttgaaccacagcctgccatggtaaaaatctca gctgagaaaaaaatggtaattaatgctcaaactgtatctgacaaattaggtagagattgg gatccacaagagttacagttagttttaatttcactagctggaaatgttgatgaagattat gaccactttacaatttattgggaaaattag

DBGET integrated database retrieval system