Anguilla rostrata (American eel): 135234287 Help Entry 135234287         CDS       T10705                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism arot  Anguilla rostrata (American eel) Pathway arot04519   Cadherin signaling arot04810   Regulation of actin cytoskeleton arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     135234287  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     135234287  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135234287 SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil ABC_tran_CTD LXG DUF5617 Motif Other DBs NCBI-GeneID:  135234287 NCBI-ProteinID:  XP_064154805 LinkDB All DBs Position 11 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaggccaggaagatccagtgcagagagagattcaccaggactgggcgaatcgggaa tatatcgaagttataacgagcagtatcaagaaaattgcagattttttgaattcgttcgat atgtcctgcaggtctcgtctggcgactttgaatgagaaactgacggcactggagaggaga attgagtatattgaggcacgggtaacaaaaggggagacattgacctag

DBGET integrated database retrieval system