Anguilla rostrata (American eel): 135235302 Help Entry 135235302         CDS       T10705                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism arot  Anguilla rostrata (American eel) Pathway arot04010   MAPK signaling pathway arot04012   ErbB signaling pathway arot04068   FoxO signaling pathway arot04137   Mitophagy - animal arot04140   Autophagy - animal arot04150   mTOR signaling pathway arot04210   Apoptosis arot04218   Cellular senescence arot04370   VEGF signaling pathway arot04371   Apelin signaling pathway arot04540   Gap junction arot04625   C-type lectin receptor signaling pathway arot04810   Regulation of actin cytoskeleton arot04910   Insulin signaling pathway arot04912   GnRH signaling pathway arot04916   Melanogenesis Brite KEGG Orthology (KO) [BR:arot00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     135235302 (nras)    04012 ErbB signaling pathway     135235302 (nras)    04370 VEGF signaling pathway     135235302 (nras)    04371 Apelin signaling pathway     135235302 (nras)    04068 FoxO signaling pathway     135235302 (nras)    04150 mTOR signaling pathway     135235302 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     135235302 (nras)    04137 Mitophagy - animal     135235302 (nras)   09143 Cell growth and death    04210 Apoptosis     135235302 (nras)    04218 Cellular senescence     135235302 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     135235302 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     135235302 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     135235302 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     135235302 (nras)    04912 GnRH signaling pathway     135235302 (nras)    04916 Melanogenesis     135235302 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arot04131]     135235302 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arot04147]     135235302 (nras)    04031 GTP-binding proteins [BR:arot04031]     135235302 (nras) Membrane trafficking [BR:arot04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     135235302 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     135235302 (nras) Exosome [BR:arot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135235302 (nras)   Exosomal proteins of other body fluids (saliva and urine)    135235302 (nras)   Exosomal proteins of breast cancer cells    135235302 (nras)   Exosomal proteins of colorectal cancer cells    135235302 (nras) GTP-binding proteins [BR:arot04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     135235302 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Beta-prop_THOC3 Ldh_1_N NB-ARC Motif Other DBs NCBI-GeneID:  135235302 NCBI-ProteinID:  XP_064156719 LinkDB All DBs Position 11:complement(5687579..5699673) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAVNNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL VRTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCSVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagcttgtggtggtgggagctggtggtgtgggaaagagtgcgctgacc atccagctgatccagaaccactttgtggacgagtatgaccccaccatcgaggactcgtac aggaagcaggtggtgatcgacggcgagacgtgcctgctggacatcctggacacggcgggt caggaggagtacagcgccatgcgggaccagtacatgaggactggcgagggcttcctctgc gtcttcgccgtcaacaacagcaagtccttcgccgacgtgcatttatacagggagcagatc aagcgggtgaaggactcggacgacgtccccatggtgctggtgggaaacaagtgcgacctg gtccgcaccgtggacaccaagcaggcccaggagctggcgcggagctacggcatcgagttc gtggagacctcggccaagaccagacagggagtggaggatgccttctacacactggtgcgg gagatccgccactaccgcatgaagaagctgaacagcagagaggacaggaagcagggctgc ttgggggtttcctgctcagtcatgtga

DBGET integrated database retrieval system