Anguilla rostrata (American eel): 135236226 Help Entry 135236226         CDS       T10705                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism arot  Anguilla rostrata (American eel) Pathway arot04145   Phagocytosis arot04517   IgSF CAM signaling arot04814   Motor proteins arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     135236226 (dynll2a)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     135236226 (dynll2a)   09142 Cell motility    04814 Motor proteins     135236226 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135236226 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arot03037]     135236226 (dynll2a)    04812 Cytoskeleton proteins [BR:arot04812]     135236226 (dynll2a) Cilium and associated proteins [BR:arot03037]  Motile cilia and associated proteins   Dynein arm    135236226 (dynll2a) Cytoskeleton proteins [BR:arot04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      135236226 (dynll2a) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  135236226 NCBI-ProteinID:  XP_064158540 LinkDB All DBs Position 12 Genome browser AA seq 89 aa AA seqDB search MADRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggctgacaggaaggctgtgataaagaatgctgacatgtctgaggacatgcagcaggat gcggtggactgtgccacgcaggccatggagaagtacaacattgagaaggacattgctgcc tacatcaagaaggagtttgacaagaagtacaaccccacgtggcattgcattgtgggcagg aactttggcagctacgttactcacgagacgaagcatttcatctacttctaccttgggcag gtggcaatcctcctcttcaagtctggctga

DBGET integrated database retrieval system