Anguilla rostrata (American eel): 135237167 Help Entry 135237167         CDS       T10705                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism arot  Anguilla rostrata (American eel) Pathway arot04137   Mitophagy - animal arot04140   Autophagy - animal arot04142   Lysosome biogenesis arot04144   Endocytosis arot04145   Phagosome arot04148   Efferocytosis arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     135237167    04145 Phagosome     135237167    04142 Lysosome biogenesis     135237167    04140 Autophagy - animal     135237167    04137 Mitophagy - animal     135237167    04148 Efferocytosis     135237167  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135237167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arot04131]     135237167   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arot04147]     135237167    04031 GTP-binding proteins [BR:arot04031]     135237167 Membrane trafficking [BR:arot04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     135237167 Exosome [BR:arot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135237167   Exosomal proteins of other body fluids (saliva and urine)    135237167   Exosomal proteins of colorectal cancer cells    135237167   Exosomal proteins of bladder cancer cells    135237167 GTP-binding proteins [BR:arot04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     135237167 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  135237167 NCBI-ProteinID:  XP_064160056 LinkDB All DBs Position 13:complement(24212845..24224458) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcccggaagaaagtgctgctgaaagtcatcattctaggagattctggagttggg aagacttctctgatgaaccagtatgtgaataaaaagtttagtaatcagtacaaagccaca ataggagctgatttcctgacaaaagaagtgatggtggacgacagacttgtcacaatgcag atctgggacacagcgggacaggagcgattccagtccttgggcgtagcattctaccgtggg gcagactgctgcgtgctggttttcgatgtgaccgcgcccaacaccttcaagaccctggac agctggagggacgagttcctgatccaggctagcccccgcgaccctgagaacttccccttt gtggtgctaggcaacaagatcgacctggagaacaggcaggtgacaaccaagcgagcgcaa gcatggtgtcaaagcaagaacaacatcccgtactttgagaccagtgccaaggaggccatc aatgttgaacaggccttccagaccatcgcacgcaacgccctgaagcaggagaccgaggtg gagttgtacaatgagttcccagagccgatcaaactggaccggaacgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system