Anguilla rostrata (American eel): 135237975
Help
Entry
135237975 CDS
T10705
Symbol
timm17a
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-A
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
arot Anguilla rostrata (American eel)
Brite
KEGG Orthology (KO) [BR:
arot00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
arot03029
]
135237975 (timm17a)
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
arot02000
]
135237975 (timm17a)
Mitochondrial biogenesis [BR:
arot03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
135237975 (timm17a)
Transporters [BR:
arot02000
]
Other transporters
Primary active transporters [TC:
3
]
135237975 (timm17a)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
135237975
NCBI-ProteinID:
XP_064161646
LinkDB
All DBs
Position
13:complement(40103041..40108851)
Genome browser
AA seq
166 aa
AA seq
DB search
MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPAGMNHRLRGSLTAIKTRAP
QLGGSFAVWGGLFSMIDCGLVKVREKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGG
ILLALIEGAGILLTRFASAQFPTSPQFAEEPAPMPAPSFGDYRQYQ
NT seq
501 nt
NT seq
+upstream
nt +downstream
nt
atggaggaatatgcacgtgaaccatgtccctggcggatagtagatgactgtggcggcgca
ttcacgatgggagccattggaggtgggatcttccaggcggtcaaaggcttccgaaattca
cctgctgggatgaaccacaggttgcgagggagtttgacggccataaagacccgggccccg
cagttaggaggcagcttcgcggtgtgggggggcctcttctccatgatcgactgcgggctg
gtgaaggtgcgggagaaggaggacccctggaactccatcaccagcggggccctgaccggg
gccatcctggccgccaggaacgggcccgttgccatggtgggctccgcggcgatggggggc
atcctgctggcgctgatcgagggtgccggcatcttgctcaccaggttcgcctcggcccag
ttccccaccagcccccagtttgcagaggagccagcgcccatgccggccccctcgttcggg
gactacagacagtatcagtga
DBGET
integrated database retrieval system