Anguilla rostrata (American eel): 135239694 Help Entry 135239694         CDS       T10705                                  Symbol zgc:100918 Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism arot  Anguilla rostrata (American eel) Pathway arot04137   Mitophagy - animal arot04140   Autophagy - animal arot04144   Endocytosis arot04145   Phagosome arot04148   Efferocytosis arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     135239694 (zgc:100918)    04145 Phagosome     135239694 (zgc:100918)    04140 Autophagy - animal     135239694 (zgc:100918)    04137 Mitophagy - animal     135239694 (zgc:100918)    04148 Efferocytosis     135239694 (zgc:100918)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135239694 (zgc:100918)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arot04131]     135239694 (zgc:100918)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arot04147]     135239694 (zgc:100918)    04031 GTP-binding proteins [BR:arot04031]     135239694 (zgc:100918) Membrane trafficking [BR:arot04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     135239694 (zgc:100918) Exosome [BR:arot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135239694 (zgc:100918)   Exosomal proteins of other body fluids (saliva and urine)    135239694 (zgc:100918)   Exosomal proteins of colorectal cancer cells    135239694 (zgc:100918)   Exosomal proteins of bladder cancer cells    135239694 (zgc:100918) GTP-binding proteins [BR:arot04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     135239694 (zgc:100918) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 AAA_16 Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_5 G-alpha ATPase_2 SRPRB NB-ARC ABC_tran NACHT AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  135239694 NCBI-ProteinID:  XP_064164631 LinkDB All DBs Position 14:40765310..40774042 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDSRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTAKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQESEV ESYDFPDQIKLSDDKPASANDSCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcggaagaaggtacttcttaaagtgataatccttggggattcgggggtgggg aaaacctctctgatgaaccagtatgttaataagaaattcagcaaccagtacaaagccacg atcggagcggatttcctcaccaaggaggttatggtggacagtcgactagtcaccatgcag atctgggacacagcaggtcaggagcgtttccagtccctgggcgtggcattctaccgcggg gcagactgctgcgtgctggtgtacgatgtgaccgcacccaacacctttaagaccctggac agctggagggacgagttcctgatccaggccagcccccgcgatcctgacaacttcccattt gtggtgctaggcaacaagatcgacctggagaacaggcaggtgacagcaaagcgagcgcag gcttggtgtcaaagtaagaataatattccctactttgagaccagcgccaaggaagctatc aacgtagagcaagccttccagaccatcgcacgcaatgcactcaagcaggagtctgaggtg gagtcctacgatttccctgatcagatcaaactgagcgatgacaaaccagcctccgccaac gacagctgcagctgctga

DBGET integrated database retrieval system