Anguilla rostrata (American eel): 135245903
Help
Entry
135245903 CDS
T10705
Symbol
slc15a5
Name
(RefSeq) solute carrier family 15 member 5
KO
K14639
solute carrier family 15, member 5
Organism
arot Anguilla rostrata (American eel)
Brite
KEGG Orthology (KO) [BR:
arot00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
arot02000
]
135245903 (slc15a5)
Transporters [BR:
arot02000
]
Solute carrier family (SLC)
SLC15: Proton oligopeptide cotransporter
135245903 (slc15a5)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PTR2
CoV_Methyltr_2
DUF4293
Motif
Other DBs
NCBI-GeneID:
135245903
NCBI-ProteinID:
XP_064175347
LinkDB
All DBs
Position
19:15361474..15379850
Genome browser
AA seq
456 aa
AA seq
DB search
MLPVVAFPFEDFYTDTHHATHTLERSEQQALFYTGLLAAALGIGGIRAILCPLGAYSVQG
YDHHRLFSFFNWFYWLVNLNSTVVFLGIAYIQQSVAKNLGFLIPFTSAVLGMLAIHMVRQ
NLTFRPKKGGSLITTLGVFLSSLKMSCLRYGYLSGEVGSWLDRAKENNGGRYSEAHVENV
KIMSRLFPLYGLQLLYRTCVAQIPSGYYLQAMHSNLKLNGFLLPIGVMNVISILPLLVLS
PLLQCSTASALSLHRTPLSPHTLIVAGHVCAALSVLAAGVSEIQRKGYPLVEQSLSGKVL
HVSSMGCFQLTPQYVLLGLAEALVTPACSLLAFRLAPGSVRGVSLNLLSLSYGGGCFLGA
LIIQLVYLLSGGNFYPDSLSDGNGNLERFFFLLAALMAINTLVFWRISYRYSDLSVELGQ
GGRSHLAEKLLQHKKCLRFYDTVERSYTLASIETIL
NT seq
1371 nt
NT seq
+upstream
nt +downstream
nt
atgctccccgtggtggcctttccgttcgaggacttctacacggacacgcaccacgccacg
cacacgctggagcgcagcgagcagcaggcgctcttctacacggggctgctggcggctgca
ctgggcatcgggggcatccgcgccatcctgtgccccctgggagcctacagcgtgcagggc
tacgaccaccacaggctcttctccttcttcaactggttctactggctagtgaacctgaac
tcgacggtggtgtttttggggatcgcctacatccagcagtctgtggccaaaaacctgggg
ttcctcatccccttcacctcggctgtgctcggcatgctcgccatccacatggtgcgccag
aacctcacctttcgccccaagaaaggcgggtcgctgatcaccacgctgggcgtgttcctg
tcctcgctgaagatgagctgcctcaggtacggctacctgagcggggaggtgggcagctgg
ctggaccgcgccaaggagaacaacggggggcgctacagcgaggcgcacgtggagaacgtc
aagatcatgtcccgcctgttccctctatacggcctgcagctgctgtaccgcacctgtgtg
gcccagatcccatctggatactacctccaggccatgcactccaacctgaagctgaacggg
ttcctgctgcccatcggggtgatgaacgtgatcagcatcctacccctgctggtgctgtcc
cccctgctgcagtgcagcactgctagtgctctgtccctgcacaggaccccactgtccccc
cacacgctcatagtggcgggacacgtctgtgctgccctgtcggtcctggccgcgggggtg
tcggagatccagaggaaggggtaccccctggtggagcagtccctttccggcaaggtgctg
cacgtctcctccatgggctgcttccagctcacgccccagtacgtcctgctgggcctggct
gaggccctggtgacccccgcctgttccctgctcgcgttccgtttggccccaggcagcgtg
cgaggggtctctctcaacctgctcagcctctcctacgggggcggctgcttcctgggggcc
ctcattatccagctggtctacctgctctccggagggaacttctacccagacagtctgagc
gacggaaacggaaacttggagcggttcttcttcctcctagcagcattaatggcgataaac
acgctggtgttctggagaatatcgtacagatacagtgatctgagtgtggagctggggcag
ggggggcggagccacctcgctgagaagctcctccagcacaagaagtgtctgcgtttctac
gacaccgtggagcgctcctacaccctggcctccatagagaccatcctgtga
DBGET
integrated database retrieval system