Anguilla rostrata (American eel): 135247296 Help Entry 135247296         CDS       T10705                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism arot  Anguilla rostrata (American eel) Pathway arot03082   ATP-dependent chromatin remodeling arot04217   Necroptosis Brite KEGG Orthology (KO) [BR:arot00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     135247296  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     135247296  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:arot03036]     135247296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arot04147]     135247296 Chromosome and associated proteins [BR:arot03036]  Eukaryotic type   Nucleosome assembly factors    Histones     135247296 Exosome [BR:arot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135247296 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  135247296 NCBI-ProteinID:  XP_064176665 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggtagggggaagaccggtggaaaagcgagagcgaaagctaaaacccgttcatcc agagctggactccagtttccggtaggtcgagttcaccgattgcttcgtaaaggaaactat gcagagcgtgttggtgccggtgctccagtttatcttgctgcagtgctcgagtatctgact gctgagatcctggaattggctggtaacgctgccagagacaacaagaaaactcgcatcatt cccagacatctgcagttggcagtgcgtaacgacgaagagttgaacaagctcctcggaggt gtcactatcgctcaggggggagtgctgcccaacatccaagctgtgttactcccgaaaaag accgagaaagcagtgaaagccaagtaa

DBGET integrated database retrieval system