Anguilla rostrata (American eel): 135249244 Help Entry 135249244         CDS       T10705                                  Name (RefSeq) elongin-B-like isoform X1   KO K03873   elongin-B Organism arot  Anguilla rostrata (American eel) Pathway arot04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:arot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     135249244  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:arot04121]     135249244    03400 DNA repair and recombination proteins [BR:arot03400]     135249244 Ubiquitin system [BR:arot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      135249244    Cul5 complex      135249244 DNA repair and recombination proteins [BR:arot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      135249244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  135249244 NCBI-ProteinID:  XP_064180746 LinkDB All DBs Position 2:38797166..38802190 Genome browser AA seq 120 aa AA seqDB search MRDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLFKDDQLLEDSKTLGD CGFTNQTARPQAPATVGLAFRINDEVFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgagagatgtgtttctcatgattcggcgccacaaaacaaccatcttcactgatgccaag gagtccaccactgtttatgagctgaagcgcattgtggaagggatcctgaaaagggcacca gaggagcagagactcttcaaggatgatcagttgttagaggacagtaagactcttggagac tgtgggttcactaatcagacagcaagacctcaggccccggccactgttggcctagctttt cgcatcaatgatgaggtgtttgagcaactgcgggtagaaccattctccagcccccctgag ctcccagatgtaatgaagccccaggactctggcagcactgctaacgagcaggccgtccag tga

DBGET integrated database retrieval system