Anguilla rostrata (American eel): 135252704 Help Entry 135252704         CDS       T10705                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism arot  Anguilla rostrata (American eel) Pathway arot04140   Autophagy - animal arot04150   mTOR signaling pathway arot04218   Cellular senescence arot04910   Insulin signaling pathway arot05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:arot00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     135252704 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     135252704 (rheb)   09143 Cell growth and death    04218 Cellular senescence     135252704 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     135252704 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     135252704 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:arot04031]     135252704 (rheb) GTP-binding proteins [BR:arot04031]  Small (monomeric) G-proteins   Ras Family    Rheb     135252704 (rheb) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RhoGAP_pG2 RsgA_GTPase YebF ParE_toxin Reovirus_M2 AAA_14 Motif Other DBs NCBI-GeneID:  135252704 NCBI-ProteinID:  XP_064187164 LinkDB All DBs Position 4:complement(18355653..18398540) Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNK KDLHMERVISCEEGKALADSWNAAFMESSAKENQTAVEVFKRIILEAEKIDGGAPQGRTS CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcccgtaagatcgccgtcctgggatacagatccgtgggaaagtcc tccttaacaatacagtttgtggaaggccagtttgtcgactcatatgatccaaccatagaa aacacatttacaaaaatgatcacagtaaatggacaggagtaccatctgcagttagtagac acagcagggcaggacgaatactcaattttcccccagacatactccatagacatcaacggc tacattctggtgtattcagtcacgtcaaacaaaagttttgaagtagtaaaagttatccat gaaaaattgttggatatggtgggaaaagttcaagtgcccattatgttggtcggaaacaag aaagacctacacatggaacgggtaatcagttgtgaagaggggaaggccttggcagattcc tggaatgcagcgtttatggagtcctccgctaaagagaaccagaccgcggtggaggtgttc aagaggataatcctggaggcggagaagattgatgggggcgctccgcaggggaggacgtcc tgctccctgatgtag

DBGET integrated database retrieval system