Anguilla rostrata (American eel): 135255998 Help Entry 135255998         CDS       T10705                                  Symbol cxcl8a Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism arot  Anguilla rostrata (American eel) Pathway arot04060   Cytokine-cytokine receptor interaction arot04218   Cellular senescence arot04620   Toll-like receptor signaling pathway arot04621   NOD-like receptor signaling pathway arot04622   RIG-I-like receptor signaling pathway arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     135255998 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     135255998 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135255998 (cxcl8a)    04621 NOD-like receptor signaling pathway     135255998 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     135255998 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135255998 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arot04052]     135255998 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:arot00536]     135255998 (cxcl8a) Cytokines and neuropeptides [BR:arot04052]  Cytokines   Chemokines    135255998 (cxcl8a) Glycosaminoglycan binding proteins [BR:arot00536]  Heparan sulfate / Heparin   Chemokines    135255998 (cxcl8a) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  135255998 NCBI-ProteinID:  XP_064193942 LinkDB All DBs Position 5 Genome browser AA seq 97 aa AA seqDB search MKSTITAAICLVFLAPLSTKGMSVRGIGVDLRCRCIETESRRMAKLIQSVELFPPSAHCK DTEIIATLKGTGQQICLDTTAPWVKKVIEKILANKKP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaagcacaatcacagctgccatatgcctggtcttcctggcccctctcagcactaaa ggaatgagtgtgcggggaataggggtggatctgcggtgtcgctgtatcgagacggagagc cgacgaatggcgaaactcatccagagtgtggagctcttccctcccagtgcccactgcaag gacacggagatcattgccactctgaaagggactggtcagcagatctgtctggacaccacc gctccctgggtcaaaaaggtcatagagaaaatcctggccaacaagaagccctaa

DBGET integrated database retrieval system