Anguilla rostrata (American eel): 135261907 Help Entry 135261907         CDS       T10705                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism arot  Anguilla rostrata (American eel) Pathway arot04382   Cornified envelope formation arot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arot00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     135261907  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     135261907  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arot04147]     135261907 Exosome [BR:arot04147]  Exosomal proteins   Exosomal proteins of microglial cells    135261907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 Dockerin_1 Bcl-2 Motif Other DBs NCBI-GeneID:  135261907 NCBI-ProteinID:  XP_064204661 LinkDB All DBs Position 8:50990591..50997176 Genome browser AA seq 101 aa AA seqDB search MPSELESCMESLIKVFHRYASKEGNSNSLSRRELKELMENELNTFLKSQKDPAAVDSIMK NLDTNGDGEVNFEEFVSLVVGLSIACEQCYQLHMKKQQAMK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccttcggagttggagagctgtatggagtccctcatcaaggtcttccaccgctacgcc tccaaggaaggcaacagcaactctcttagccgccgggagctcaaggagctgatggagaac gagctgaacacgttcctcaagagtcagaaggaccctgctgcggtggacagcatcatgaag aacctggacaccaacggagacggggaggtgaactttgaggagtttgtctccctggtggtg gggctctccattgcctgcgagcagtgttaccagttgcacatgaagaaacagcaggccatg aagtga

DBGET integrated database retrieval system