Apteryx rowi (Okarito brown kiwi): 112962697 Help Entry 112962697         CDS       T07573                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04010   MAPK signaling pathway arow04012   ErbB signaling pathway arow04068   FoxO signaling pathway arow04137   Mitophagy - animal arow04140   Autophagy - animal arow04144   Endocytosis arow04150   mTOR signaling pathway arow04210   Apoptosis arow04218   Cellular senescence arow04370   VEGF signaling pathway arow04371   Apelin signaling pathway arow04510   Focal adhesion arow04540   Gap junction arow04625   C-type lectin receptor signaling pathway arow04810   Regulation of actin cytoskeleton arow04910   Insulin signaling pathway arow04912   GnRH signaling pathway arow04916   Melanogenesis arow05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arow00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112962697 (HRAS)    04012 ErbB signaling pathway     112962697 (HRAS)    04370 VEGF signaling pathway     112962697 (HRAS)    04371 Apelin signaling pathway     112962697 (HRAS)    04068 FoxO signaling pathway     112962697 (HRAS)    04150 mTOR signaling pathway     112962697 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112962697 (HRAS)    04140 Autophagy - animal     112962697 (HRAS)    04137 Mitophagy - animal     112962697 (HRAS)   09143 Cell growth and death    04210 Apoptosis     112962697 (HRAS)    04218 Cellular senescence     112962697 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112962697 (HRAS)    04540 Gap junction     112962697 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112962697 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112962697 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112962697 (HRAS)    04912 GnRH signaling pathway     112962697 (HRAS)    04916 Melanogenesis     112962697 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112962697 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arow04131]     112962697 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arow04147]     112962697 (HRAS)    04031 GTP-binding proteins [BR:arow04031]     112962697 (HRAS) Membrane trafficking [BR:arow04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112962697 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112962697 (HRAS) Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112962697 (HRAS)   Exosomal proteins of colorectal cancer cells    112962697 (HRAS) GTP-binding proteins [BR:arow04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112962697 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  112962697 NCBI-ProteinID:  XP_025914887 Ensembl:  ENSARWG00000008304 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagctggtggtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgaatatgaccccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacctgtttgttagacatcttggacacggcaggg caagaggagtacagtgccatgcgagaccagtacatgagaacaggggagggattcctgtgc gtcttcgccattaacaacacaaagtcttttgaagatattcaccagtacagagagcagatc aagagggtgaaagactcggatgatgttcccatggtgctggtgggaaataaatgtgacctg ccagctcggacagtggagacccggcaagcacaggacctggcccgcagttacgggatccct tacatagaaacgtctgccaaaaccagacagggtgttgaagatgccttctacaccttagtg cgggagatccgtcagcacaaactacgcaagctgaatccaccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system