Apteryx rowi (Okarito brown kiwi): 112962889 Help Entry 112962889         CDS       T07573                                  Name (RefSeq) histone H2A-IV   KO K11251   histone H2A Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow03082   ATP-dependent chromatin remodeling arow04217   Necroptosis Brite KEGG Orthology (KO) [BR:arow00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112962889  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112962889  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:arow03036]     112962889   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arow04147]     112962889 Chromosome and associated proteins [BR:arow03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112962889 Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112962889 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  112962889 NCBI-ProteinID:  XP_025915231 Ensembl:  ENSARWG00000013704 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TDSHKAKAK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcgggaagcagggcgggaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaaaggcaactac gcggagcgggtgggcgccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcgcgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcgcagggcggcgtgctgcccaacatccaggcggtgctgctgcccaagaag accgacagccataaggctaaagccaagtga

DBGET integrated database retrieval system