Apteryx rowi (Okarito brown kiwi): 112964212 Help Entry 112964212         CDS       T07573                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow03082   ATP-dependent chromatin remodeling arow04217   Necroptosis Brite KEGG Orthology (KO) [BR:arow00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112964212  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112964212  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:arow03036]     112964212   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arow04147]     112964212 Chromosome and associated proteins [BR:arow03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112964212 Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112964212 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  112964212 NCBI-ProteinID:  XP_025917776 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search AVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQ AVLLPKKTESHKAKSK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gccgtgctggagtacctgacggccgagatcctggagctggcgggcaacgcggcgcgcgac aacaagaagacgcgcatcatcccgcgccacctgcagctggccatccgcaacgacgaggag ctcaacaagctgctgggcaaggtcaccatcgcgcagggcggcgtgctgcccaacatccag gcggtgctattgcccaagaagactgagagtcataaggccaagagcaagtaa

DBGET integrated database retrieval system