Apteryx rowi (Okarito brown kiwi): 112965180 Help Entry 112965180         CDS       T07573                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow02010   ABC transporters Brite KEGG Orthology (KO) [BR:arow00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     112965180 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:arow02000]     112965180 (DEFB1)    03037 Cilium and associated proteins [BR:arow03037]     112965180 (DEFB1) Transporters [BR:arow02000]  Other transporters   Pores ion channels [TC:1]    112965180 (DEFB1) Cilium and associated proteins [BR:arow03037]  Motile cilia and associated proteins   Sperm associated proteins    112965180 (DEFB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  112965180 NCBI-ProteinID:  XP_025919738 LinkDB All DBs Position Unknown AA seq 65 aa AA seqDB search MKTLFLLLALLLVSSSSPVSQATAVSDTVMCRKIGGKCSFLICPFFKRPNGTCYXGLAKC CRPLW NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaagacactcttcctgctgcttgctcttctccttgtctcctcgtcttctccagtgtct caagccactgcagtgtcagacactgttatgtgtcggaagatcgggggcaaatgttcattc ttgatatgtcccttctttaagagacccaacggcacctgctacrgtggactagcgaagtgc tgcagacccctctggtga

DBGET integrated database retrieval system