Apteryx rowi (Okarito brown kiwi): 112965801 Help Entry 112965801         CDS       T07573                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04810   Regulation of actin cytoskeleton arow05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arow00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112965801 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112965801 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arow04131]     112965801 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:arow04812]     112965801 (PFN2)    04147 Exosome [BR:arow04147]     112965801 (PFN2) Membrane trafficking [BR:arow04131]  Others   Actin-binding proteins    Others     112965801 (PFN2) Cytoskeleton proteins [BR:arow04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112965801 (PFN2) Exosome [BR:arow04147]  Exosomal proteins   Proteins found in most exosomes    112965801 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112965801 NCBI-ProteinID:  XP_025920957 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search QPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAV GRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt cagccagtagaaatagatatgattgtaggaaaagaccgagaggggttcttcaccaatggt ctgacccttggtgcaaagaagtgctctgtgatcagagatagcctgtacgttgatggcgac tgcacaatggacatcaggacaaagagtcaaggtggtgagccaacgtacaatgttgctgta ggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcgga ttgaataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system