Apteryx rowi (Okarito brown kiwi): 112966869 Help Entry 112966869         CDS       T07573                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow03272   Virion - Hepatitis viruses arow04382   Cornified envelope formation arow04514   Cell adhesion molecule (CAM) interaction arow04530   Tight junction Brite KEGG Orthology (KO) [BR:arow00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     112966869 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     112966869 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     112966869 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112966869 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arow03037]     112966869 (CLDN19)    04147 Exosome [BR:arow04147]     112966869 (CLDN19) Cilium and associated proteins [BR:arow03037]  Other cilia and associated proteins   Stereociliary proteins    112966869 (CLDN19) Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    112966869 (CLDN19)   Exosomal proteins of colorectal cancer cells    112966869 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF202 Motif Other DBs NCBI-GeneID:  112966869 NCBI-ProteinID:  XP_025923192 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MGPSFPVGPSPHRPPCPHGAQTCEKITARKSAAGRKAGSRREDGAAGARKLWAVFFLFSQ LFFPPPAHIQTSRALMVVSLLLGFFGLIVSVVGMKCTKVGEDDPVTKGRXAVAGGILFIL SGLCTLAAVSSYAARVTYEFFSPSTPVNAR NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgggtccgagcttccccgtgggtcccagcccccatcgccccccgtgtccccacggggct cagacctgcgagaaaatcacagcgaggaagagcgcggctgggaggaaggccgggagccgg cgcgaggacggggccgccggcgcccggaaactttgggctgttttttttttattttcccag cttttttttccccccccagcccacatccagacctcgcgggccctcatggtggtctccctc ctcctcggcttcttcggcctcatcgtgagcgtcgtgggcatgaagtgcaccaaggtgggc gaggacgatcccgtcaccaagggccgcrtcgccgtcgccggcggcatcctcttcatcctc tctggtctctgcacgctggccgccgtctcctcgtacgccgcgcgggtcacctacgagttc ttcagccccagcacccccgtcaacgccaggtga

DBGET integrated database retrieval system