Apteryx rowi (Okarito brown kiwi): 112968579 Help Entry 112968579         CDS       T07573                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow03272   Virion - Hepatitis viruses arow04382   Cornified envelope formation arow04514   Cell adhesion molecule (CAM) interaction arow04530   Tight junction Brite KEGG Orthology (KO) [BR:arow00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     112968579 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     112968579 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     112968579 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112968579 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arow03037]     112968579 (CLDN1)    04147 Exosome [BR:arow04147]     112968579 (CLDN1) Cilium and associated proteins [BR:arow03037]  Other cilia and associated proteins   Stereociliary proteins    112968579 (CLDN1) Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    112968579 (CLDN1)   Exosomal proteins of colorectal cancer cells    112968579 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Cytochrom_B_C CD20 DUF1218 DUF4134 OppC_N Motif Other DBs NCBI-GeneID:  112968579 NCBI-ProteinID:  XP_025926794 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MSIPSGLGSLQATRALMVSAILLGLVAIFVAVTGMKCMKCMEDDQVKKMRMAVFGGXIFI IAGMAALVATSWYGNRVAQAFYNPSTPVNSRYEFGSALFVGWAAASLAMLGGAFLCCSCP RQETSYPPTRGYPKNAPSTGKDYV NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgtccatcccgtcggggctgggcagtctgcaggccactcgggcattgatggtgtctgca attctcctgggccttgttgccatatttgttgctgtgactggcatgaaatgcatgaagtgc atggaagatgaccaggtgaaaaagatgaggatggctgtctttggtggagygattttcatc attgcaggaatggcagcactggtggccacatcgtggtatggcaacagagtggctcaggcc ttctataacccttccacccctgtcaactccagatatgaatttggatcagccctcttcgtt ggctgggcagctgcttctctggccatgctgggaggagccttcctctgctgctcctgcccc cggcaagaaacctcttatccacccacccgaggctatccgaaaaatgccccctccacaggg aaggattatgtataa

DBGET integrated database retrieval system