Apteryx rowi (Okarito brown kiwi): 112969357 Help Entry 112969357         CDS       T07573                                  Symbol DNAL4 Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04814   Motor proteins Brite KEGG Orthology (KO) [BR:arow00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     112969357 (DNAL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arow03037]     112969357 (DNAL4)    04812 Cytoskeleton proteins [BR:arow04812]     112969357 (DNAL4) Cilium and associated proteins [BR:arow03037]  Motile cilia and associated proteins   Dynein arm    112969357 (DNAL4) Cytoskeleton proteins [BR:arow04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112969357 (DNAL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light GARS_A DUF6935 Motif Other DBs NCBI-GeneID:  112969357 NCBI-ProteinID:  XP_025928371 Ensembl:  ENSARWG00000017865 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MADTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVEAMELCVTACEKYATNNESAAKMIKE MMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagacactggggaggggaaaaaggaggaagctgattataaaagacttcacagcttt ccactgattaggcacacggacatgccagaggagatgcgtgtggaagctatggagctgtgt gtcacggcgtgtgagaaatatgccaccaacaacgagagtgctgccaagatgatcaaagag atgatggacaagaaatttggatcctcctggcatgtggtgattggggaaggttttggcttt gagatcactcacgaggtgaagaatctgctatacatgttctttggtggcagcctggctgtg tgtgtctggaagtgctcgtga

DBGET integrated database retrieval system