Apteryx rowi (Okarito brown kiwi): 112971673 Help Entry 112971673         CDS       T07573                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04010   MAPK signaling pathway arow04012   ErbB signaling pathway arow04068   FoxO signaling pathway arow04137   Mitophagy - animal arow04140   Autophagy - animal arow04150   mTOR signaling pathway arow04210   Apoptosis arow04218   Cellular senescence arow04370   VEGF signaling pathway arow04371   Apelin signaling pathway arow04540   Gap junction arow04625   C-type lectin receptor signaling pathway arow04810   Regulation of actin cytoskeleton arow04910   Insulin signaling pathway arow04912   GnRH signaling pathway arow04916   Melanogenesis Brite KEGG Orthology (KO) [BR:arow00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112971673 (NRAS)    04012 ErbB signaling pathway     112971673 (NRAS)    04370 VEGF signaling pathway     112971673 (NRAS)    04371 Apelin signaling pathway     112971673 (NRAS)    04068 FoxO signaling pathway     112971673 (NRAS)    04150 mTOR signaling pathway     112971673 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112971673 (NRAS)    04137 Mitophagy - animal     112971673 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112971673 (NRAS)    04218 Cellular senescence     112971673 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112971673 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112971673 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112971673 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112971673 (NRAS)    04912 GnRH signaling pathway     112971673 (NRAS)    04916 Melanogenesis     112971673 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arow04131]     112971673 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arow04147]     112971673 (NRAS)    04031 GTP-binding proteins [BR:arow04031]     112971673 (NRAS) Membrane trafficking [BR:arow04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112971673 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112971673 (NRAS) Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112971673 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112971673 (NRAS)   Exosomal proteins of breast cancer cells    112971673 (NRAS)   Exosomal proteins of colorectal cancer cells    112971673 (NRAS) GTP-binding proteins [BR:arow04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112971673 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  112971673 NCBI-ProteinID:  XP_025933076 Ensembl:  ENSARWG00000017079 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggattcatat agaaagcaggttgttattgatggagaaacgtgtttgttagacattctggacactgctgga caggaagagtatagcgccatgcgtgaccaatacatgagaactggggaaggattcctctgt gtttttgctattaacaatagtaaatcatttgctgatattaacctttacagagaacagata aagagagtgaaagactcagatgatgtgccaatggtgctagtagggaataagtgtgattta cccacaagaacagtagacacaaagcaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacaagacagggtgtggaagatgctttttacacactggtg agagagatccggcagtaccggatgaaaaagctcaacagcagcgaagatgggaatcaaggc tgtatgggattgtcttgtatcgtgatgtga

DBGET integrated database retrieval system