Apteryx rowi (Okarito brown kiwi): 112972450 Help Entry 112972450         CDS       T07573                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04010   MAPK signaling pathway arow04068   FoxO signaling pathway arow04081   Hormone signaling arow04114   Oocyte meiosis arow04140   Autophagy - animal arow04150   mTOR signaling pathway arow04810   Regulation of actin cytoskeleton arow04910   Insulin signaling pathway arow04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:arow00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112972450 (INS)    04068 FoxO signaling pathway     112972450 (INS)    04150 mTOR signaling pathway     112972450 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     112972450 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112972450 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     112972450 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112972450 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112972450 (INS)    04914 Progesterone-mediated oocyte maturation     112972450 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arow04052]     112972450 (INS) Cytokines and neuropeptides [BR:arow04052]  Neuropeptides   Unclassified    112972450 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta CLP_protease Motif Other DBs NCBI-GeneID:  112972450 NCBI-ProteinID:  XP_025934794 Ensembl:  ENSARWG00000010690 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGLLRGEAEELPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatccctgcctctcctggcccttctcgctctctctggccctggg accagccacgcagctgccaaccagcacctctgtggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagcccggcgggacattgaacag cctctagtgagtgggctactgcgtggcgaggcagaagagctgccgttccagcaggaggaa tatgagaaagtgaagagaggaattgttgagcaatgctgccataacacgtgctccctctac caactggaaaactattgcaactag

DBGET integrated database retrieval system