Apteryx rowi (Okarito brown kiwi): 112972946 Help Entry 112972946         CDS       T07573                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04144   Endocytosis Brite KEGG Orthology (KO) [BR:arow00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112972946 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arow04131]     112972946 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arow04147]     112972946 (RAB10)    04031 GTP-binding proteins [BR:arow04031]     112972946 (RAB10) Membrane trafficking [BR:arow04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     112972946 (RAB10)  Protein recycling   Rab GTPases and associated proteins     112972946 (RAB10) Exosome [BR:arow04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112972946 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    112972946 (RAB10)   Exosomal proteins of colorectal cancer cells    112972946 (RAB10)   Exosomal proteins of bladder cancer cells    112972946 (RAB10) GTP-binding proteins [BR:arow04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     112972946 (RAB10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Efg1 DUF3963 Motif Other DBs NCBI-GeneID:  112972946 NCBI-ProteinID:  XP_025935976 Ensembl:  ENSARWG00000004306 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MGRRMSHLSQKGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDI TNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVPKAKGEQIAREHGIRFFET SAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggggaggaggatgtcacacttgtcacagaaagggatagacttcaagattaaaactgtt gaattacaaggaaagaagatcaagctacagatatgggacacagcagggcaggaacgattt cacaccatcaccacctcttattacagaggtgccatgggaatcatgctagtatacgacatc accaacgccaagagctttgaaaacatcagcaagtggctcagaaacatagatgagcatgcc aatgaagatgtggagaggatgctgttaggaaacaagtgtgacatggaagataaaagagtt gtccctaaagcaaaaggagaacagattgctagggagcatggtattaggtttttcgaaact agtgcaaaagcaaatataaacattgagaaggcattcctcacattagcagaagacattctt cgaaagacccctgtaaaagagcccaacagtgaaaatgtagatatcagcagtggaggtggg gtgacaggctggaagagcaagtgttgctga

DBGET integrated database retrieval system