Apteryx rowi (Okarito brown kiwi): 112976957 Help Entry 112976957         CDS       T07573                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism arow  Apteryx rowi (Okarito brown kiwi) Brite KEGG Orthology (KO) [BR:arow00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:arow03041]     112976957 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arow04052]     112976957 (UBL5) Spliceosome [BR:arow03041]  Complex B   Other components    Complex B specific factors     112976957 (UBL5) Cytokines and neuropeptides [BR:arow04052]  Neuropeptides   Unclassified    112976957 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 DUF5343 Motif Other DBs NCBI-GeneID:  112976957 NCBI-ProteinID:  XP_025944528 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTEDSIRDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagtcgtctgcaacgaccgtctgggaaagaaggtgcgggtaaaatgcaacacc gaggactccatccgcgacctgaagaagctgatcgcggcgcagacggggacccgctgggac aagatcgtgctcaagaagtggtacacgatcttcaaggaccacgtcacgctgggagactat gagatccatgatggcatgaacctggagctctactaccagtag

DBGET integrated database retrieval system