Apteryx rowi (Okarito brown kiwi): 112977596 Help Entry 112977596         CDS       T07573                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow04060   Cytokine-cytokine receptor interaction arow04218   Cellular senescence arow04620   Toll-like receptor signaling pathway arow04621   NOD-like receptor signaling pathway arow04622   RIG-I-like receptor signaling pathway arow05132   Salmonella infection arow05164   Influenza A Brite KEGG Orthology (KO) [BR:arow00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112977596  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112977596  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112977596    04621 NOD-like receptor signaling pathway     112977596    04622 RIG-I-like receptor signaling pathway     112977596  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112977596   09171 Infectious disease: bacterial    05132 Salmonella infection     112977596  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arow04052]     112977596    00536 Glycosaminoglycan binding proteins [BR:arow00536]     112977596 Cytokines and neuropeptides [BR:arow04052]  Cytokines   Chemokines    112977596 Glycosaminoglycan binding proteins [BR:arow00536]  Heparan sulfate / Heparin   Chemokines    112977596 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112977596 NCBI-ProteinID:  XP_025945889 Ensembl:  ENSARWG00000002794 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNGRLVAVLALVLISAAVSHGMALARMGNELRCQCIATHSKFINPRSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIIKSILAKAKSNTDTPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcagacttgtggctgtcctggctcttgtcctgatctcagcagctgtgtctcat ggtatggccctggcaaggatgggaaatgagctccggtgccagtgcatagccactcattcg aagttcatcaaccctagatccattcaagatgtaaagctgacgcaaagcggacctcactgc aagaacgtggaagtcatagctactctgaaggacggcagagaagtgtgtttggagcccacc gctccctgggttcagctgatcataaagtcaattttggccaaggctaagtccaatactgat acaccactctaa

DBGET integrated database retrieval system