Limnospira platensis: NIES39_E00260 Help Entry NIES39_E00260     CDS       T02608                                  Name (GenBank) hypothetical protein   KO K03666   host factor-I protein Organism arp  Limnospira platensis Pathway arp02024   Quorum sensing arp03018   RNA degradation Brite KEGG Orthology (KO) [BR:arp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NIES39_E00260  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NIES39_E00260  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:arp03019]     NIES39_E00260    03036 Chromosome and associated proteins [BR:arp03036]     NIES39_E00260 Messenger RNA biogenesis [BR:arp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NIES39_E00260 Chromosome and associated proteins [BR:arp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NIES39_E00260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  BAI90261 LinkDB All DBs Position 2423794..2424006 Genome browser AA seq 70 aa AA seqDB search MPEFNTDLPSVRKLQTYIKDKPTVKIQLLTEDMLEGQMLWQDPNCICLQPPQGEPILVWR EAIAYIQAKS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcccgagttcaataccgatttacccagcgtccgcaagttacaaacctacatcaaggat aaacccactgttaagattcaattactcaccgaagatatgttagagggccaaatgctgtgg caagatcctaactgtatctgtttacaacccccacagggggaaccgattttggtctggcga gaggcgatcgcctatatacaagccaaatcttga

DBGET integrated database retrieval system