Limnospira platensis: NIES39_G00220
Help
Entry
NIES39_G00220 CDS
T02608
Name
(GenBank) hypothetical protein
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
arp
Limnospira platensis
Brite
KEGG Orthology (KO) [BR:
arp00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
arp01002
]
NIES39_G00220
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
arp01011
]
NIES39_G00220
Enzymes [BR:
arp01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
NIES39_G00220
Peptidases and inhibitors [BR:
arp01002
]
Serine peptidases
Family S66
NIES39_G00220
Peptidoglycan biosynthesis and degradation proteins [BR:
arp01011
]
Precursor biosynthesis
Carboxypeptidase
NIES39_G00220
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
BAI90806
LinkDB
All DBs
Position
2997071..2998072
Genome browser
AA seq
333 aa
AA seq
DB search
MKNRRQFLNGLGLTLLATGFPVLASSPNPIKPPRLRAGDTVGIIAPSGWITRQELKFLTL
QLMQQGLNLKAAPHLMDKYGYLAGLDRDRAADVNTMFADPNIRGIIAAAGGWGAARILPL
LDYNIIRNNPKVIIGYSDITSLLLAIYSQCNFITFHGLLGTSHWQSFSVNYLKRVLFSAE
AVTFENPGNIRVETITSGSARGQLVGGNLSVLAALVGSEYLPNWSGKILFIEDINEDVYR
VDRLLTQLKLAGILDQLSGFIFGQCSRCSPGREGESSFSLWEVLVDHIQPLGIPAWYGSA
IGHIRAQFTIAIGGMVEINSDRGTIQMLEAAVS
NT seq
1002 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaatcgccgccaatttctcaatgggttaggtttgacacttttagcaacaggattt
ccggtattagcatcctctcctaatcctattaaaccaccccggttgcgggctggggatacg
gtgggaataattgcgccttctggatggattaccagacaggagttaaaatttctaactttg
caattaatgcaacaaggacttaatctgaaagctgcgcctcacctgatggataaatatggt
tatttagctggattagatcgagaccgcgccgccgatgttaataccatgtttgctgatccg
aatattcggggaattattgccgccgctggtggctggggggctgcgcgtattttacccttg
ttggattataacataatccgcaacaatcccaaggtgattattggttatagtgatatcacc
tcattattattagccatatattcccagtgtaattttatcacatttcacggcttattagga
acttcccattggcagagtttttcggtgaattacttaaagcgagtgttgttttccgccgaa
gctgttacctttgaaaatcctgggaatattcgggtagaaactattaccagcggtagcgct
aggggtcaactggtggggggtaatttatcagttttagcggcgttggtgggttctgaatat
ctaccgaattggtcgggaaaaattttatttattgaggatattaacgaggatgtttaccgg
gtcgatcgcctattgactcaattaaaactagccggaattttagatcaattatccgggttt
attttcggacaatgtagccgttgttcacctgggagggaaggggaatcatcctttagttta
tgggaagtgttagttgatcatattcaacccctaggaatacccgcctggtatggttcagcc
ataggtcatattcgcgcccaatttaccatagccataggcggtatggtagaaattaatagc
gatcgcggaactatccaaatgctagaagccgcagttagctaa
DBGET
integrated database retrieval system