Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:arp00001]
09100 Metabolism
09102 Energy metabolism
00195 Photosynthesis
NIES39_G00250 (psaD)
09180 Brite Hierarchies
09181 Protein families: metabolism
00194 Photosynthesis proteins [BR:arp00194]
NIES39_G00250 (psaD)
Photosynthesis proteins [BR:arp00194]
Photosystem and electron transport system
Photosystem I (P700 chlorophyll a) [OT]
Main subunits
NIES39_G00250 (psaD)
142 aa
MVETLTGKAPKFGGSTGGLLTKAQVEEKYAITWTSTKEQVFEMPTGGAAIMNEGENLLYL
ARKEQCLALGTQLRTKFKPKIEDFKIYRIFPNGEMEYLHPKDGVFPEKVNEGREFNGKID
RKIGDNPNPASVKFSGKATYES