KEGG   Limnospira platensis: NIES39_Q02290
Entry
NIES39_Q02290     CDS       T02608                                 
Symbol
psaC
Name
(GenBank) photosystem I iron-sulfur protein PsaC
  KO
K02691  photosystem I iron-sulfur center [EC:1.97.1.12]
Organism
arp  Limnospira platensis
Pathway
arp00195  Photosynthesis
arp01100  Metabolic pathways
Module
arp_M00163  Photosystem I
arp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    NIES39_Q02290 (psaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:arp00194]
    NIES39_Q02290 (psaC)
Enzymes [BR:arp01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.12  photosystem I
     NIES39_Q02290 (psaC)
Photosynthesis proteins [BR:arp00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    NIES39_Q02290 (psaC)
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_6 Fer4_4 Fer4_21 Fer4_2 Fer4_10 Fer4_16 Fer4_9 Fer4_17 Fer4_22 Fer4_13 Fer4_8 Fer4_3 Fer4_15 Fer4_18 Fer4_ETF_QO Fer4_Nqo3 Phage_zn_bind_4
Other DBs
NCBI-ProteinID: BAI94237
LinkDB
Position
complement(6541888..6542133)
AA seq 81 aa
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCIGCKRCETACPT
DFLSVRVYLGAETTRSMGLAY
NT seq 246 nt   +upstreamnt  +downstreamnt
atgtctcattccgtcaaaatttacgatacctgtattggttgcacccagtgtgttcgcgct
tgtcccttggatgtgctagaaatggtaccctgggatggctgtaaagctggtcaaattgct
tcctctccccgtaccgaagactgcatcggttgtaagcggtgtgagactgcttgtcctact
gacttcctcagcgttcgggtttacctcggtgctgaaactacccgcagtatgggtctggct
tactaa

DBGET integrated database retrieval system