Arthrobacter sp. Rue61a: ARUE_c38760 Help Entry ARUE_c38760       CDS       T02215                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism arr  Arthrobacter sp. Rue61a Brite KEGG Orthology (KO) [BR:arr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:arr03032]     ARUE_c38760 (hup)    03036 Chromosome and associated proteins [BR:arr03036]     ARUE_c38760 (hup)    03400 DNA repair and recombination proteins [BR:arr03400]     ARUE_c38760 (hup) DNA replication proteins [BR:arr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ARUE_c38760 (hup) Chromosome and associated proteins [BR:arr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ARUE_c38760 (hup) DNA repair and recombination proteins [BR:arr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ARUE_c38760 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AFR30754 LinkDB All DBs Position complement(4254999..4255286) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaactcgttgcagaggtagcaggcaaggctggcaccagccag gcagcagtcaactccgtgctcgatgcactgttcgaagttttcgagacttctgtcgccgcc ggcgaaaagatcaccatcccgggctggctcgcagttgagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggcgaaaccatccagatcgcagccggccacagcgtcaag ctgaccgctggctccaagctgaaggctgctgtcgccaagaagaagtaa

DBGET integrated database retrieval system