Arsenophonus sp. aPb: QE177_08695 Help Entry QE177_08695       CDS       T11176                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arse  Arsenophonus sp. aPb Pathway arse01100   Metabolic pathways arse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QE177_08695 (acpP)    00074 Mycolic acid biosynthesis     QE177_08695 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QE177_08695 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WGL97303 UniProt:  A0AA95GIF1 LinkDB All DBs Position complement(1946321..1946557) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIAEHLGVKQEEVINNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtactatagaagaacgtgttaagaaaataattgctgaacatttaggtgttaaacaa gaggaagtcataaataatgcttcattcgttgaggatttaggtgcagattctcttgacact gttgaactagtaatggcattagaagaagagtttgataccgaaattcctgatgaagaagca gaaaaaatcacgacagtgcaagcagctattgattatatcaatagtcataaaggataa

DBGET integrated database retrieval system