Arthrobacter sp. FB24: Arth_2324 Help Entry Arth_2324         CDS       T00421                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism art  Arthrobacter sp. FB24 Brite KEGG Orthology (KO) [BR:art00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Arth_2324 Enzymes [BR:art01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Arth_2324 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ABK03704 UniProt:  A0JXD4 LinkDB All DBs Position 2614615..2614872 Genome browser AA seq 85 aa AA seqDB search MDFTPESGTITMFSTTWCGYCNRLKKQLDAQGIGYTEINIEEVEGTADLVEQLNGGNRTV PTVLFPDGTAATNPSAAEVKSRLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggatttcactcccgaatccggcaccatcaccatgttttcgaccacctggtgcggatac tgcaaccggctgaagaagcagttggacgcccagggcatcggttacaccgagatcaacatc gaagaagtcgaaggcaccgccgacctcgtggaacagctcaacggaggcaaccgcaccgtc cccaccgtgctattcccggacggtaccgccgccaccaacccgtcggcagccgaagtaaag agccggctcgcggcctag

DBGET integrated database retrieval system