KEGG   Arthrobacter sp. EM1: QI450_00795
Entry
QI450_00795       CDS       T11381                                 
Name
(GenBank) acyl-CoA dehydrogenase family protein
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
arte  Arthrobacter sp. EM1
Pathway
arte00071  Fatty acid degradation
arte00310  Lysine degradation
arte00362  Benzoate degradation
arte00380  Tryptophan metabolism
arte01100  Metabolic pathways
arte01110  Biosynthesis of secondary metabolites
arte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arte00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    QI450_00795
  09105 Amino acid metabolism
   00310 Lysine degradation
    QI450_00795
   00380 Tryptophan metabolism
    QI450_00795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QI450_00795
Enzymes [BR:arte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     QI450_00795
SSDB
Other DBs
NCBI-ProteinID: WGZ79832
LinkDB
Position
161308..162534
AA seq 408 aa
MRPAGLAESPASAASTEGLPTADFFGFEAMLNAAEQAKLAELRDFLAREVAPYAADWWNR
AEFPAHILPKLAALELSAPAQRGYSNLFAGLVIAEMTRVDTSLATFFLVHHDLFVEALYG
FGSAEQKARLLDDAANLRTTGAFALTEPEHGSDVAGGMESVARRVRGGAPGGGDTWVLNG
AKRWIGNGTFCDYMLVWARDEDGGGIRGFIVDATLPGVSRSRIENKIALRTVQNADIVFT
DVQVAESDRFAGINSFEDTNELLRGSRIMVAWQGVGQQLAAFDVARQYAVERRQFGRPLA
KFQLVQQQLVTMLGNAVASMGMMVRIAQLQDAGAADMPQVALAKSYVSARMRETVGMGRS
LLGGNGIVTDYRMAKIFADAEAIYTYEGSYEINTLIVGRAVTGVSAIV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaggccggccgggttggccgagtcgccggcgtccgctgcgtcaaccgagggccttcca
accgcggacttcttcggcttcgaggcgatgctcaacgccgcggaacaggctaagctcgcc
gaactgcgggacttcctggcccgggaagtggcaccctacgcggccgactggtggaatagg
gccgagttccccgcccacatcctgcccaagctggcggccctggagctcagcgcaccggcc
cagcgcggctacagcaacctgtttgccgggctggtgatcgccgagatgacccgggtggat
acctcgctggcgacgtttttcctggtccatcacgatctttttgtcgaagccctttacggc
ttcggctccgcggagcagaaggcgcggctgctcgatgacgccgcgaacctccggaccacc
ggggcgttcgccctgaccgagcctgaacacggctccgatgtggccggtggcatggaatcc
gttgcccggcgggtccgcggcggggcgcccggcggcggcgacacctgggtgctcaacggc
gccaagcgatggatcggcaacgggacgttctgcgactacatgctggtctgggcccgcgac
gaggacggcggcggcatccgcggctttattgtggacgcgaccctgccgggcgtgagccgg
agcaggatcgagaacaagatcgcgctgcgcacggtgcagaacgcggacatcgtcttcacc
gacgtccaggtggcagagtcggaccgtttcgcagggatcaacagcttcgaggacaccaat
gaactgctgcgcgggtcgcggatcatggtcgcctggcagggtgttggccagcaattggcc
gcgttcgacgtcgcccggcagtacgccgtcgaacgccggcagttcggccgcccgctggcg
aaattccagctggtccagcagcagctggtgacgatgctcggcaatgcagtggcgagcatg
ggcatgatggtccggatcgcacagctgcaggatgcgggagccgcggacatgccgcaggtg
gcgcttgcgaagtcctatgtgagcgcccggatgcgggaaaccgtggggatgggccggtcc
ctgctgggcggcaacggcattgtcaccgactaccggatggccaagatcttcgccgacgcc
gaggcgatttacacctatgagggctcgtacgagatcaacaccctgatcgtcgggcgggcc
gtgaccggggtttccgcgatcgtctag

DBGET integrated database retrieval system