Arthrobacter sp. EM1: QI450_15350 Help Entry QI450_15350       CDS       T11381                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism arte  Arthrobacter sp. EM1 Brite KEGG Orthology (KO) [BR:arte00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:arte03032]     QI450_15350    03036 Chromosome and associated proteins [BR:arte03036]     QI450_15350    03400 DNA repair and recombination proteins [BR:arte03400]     QI450_15350 DNA replication proteins [BR:arte03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QI450_15350 Chromosome and associated proteins [BR:arte03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QI450_15350 DNA repair and recombination proteins [BR:arte03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QI450_15350 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WGZ79211 LinkDB All DBs Position complement(3317209..3317496) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVSKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaacttgttgcagaggtagcaggcaaggccggcaccagccag gcagccgtcaactccgtgctggatgcattgttcgaggtcttcgagacctctgtcgccgcc ggcgagaagatcaccatcccgggctggcttgcagttgagcgcaccgaccgtgccgctcgc accggccgcaacccgcagacgggcgagaccatccagatcgccgcgggccacagcgtcaag ctgaccgccggctccaagctgaaggctgcggtttccaagaagaagtag

DBGET integrated database retrieval system