KEGG   Arthrobacter sp. PGP41: C3B78_12090
Entry
C3B78_12090       CDS       T05450                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00770  Pantothenate and CoA biosynthesis
arth01100  Metabolic pathways
arth01240  Biosynthesis of cofactors
Module
arth_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C3B78_12090
Enzymes [BR:arth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     C3B78_12090
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig FAD_syn Pantoate_ligase HIGH_NTase1
Other DBs
NCBI-ProteinID: AUZ35126
LinkDB
Position
complement(2649526..2650026)
AA seq 166 aa
MRRAVCPGSFDPIHNGHLEVIARAAGLFDEVIVAVSTNQAKQYRFALQERLDMARETLAS
LKGIVVEPVGEGLLAEYCRQRGVSAIVKGLRSSSDFDYELPMATMNRQLSGVETVFLPAE
AHYLHLSSTLIKEVAGLGGNVSDYVPRSVQRRMLAGESGPGQQPRG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagacgcgctgtctgccccggatcctttgaccccatccacaacggccatctcgaggtt
attgcgcgtgccgccggcctctttgacgaggtcatcgtggctgtgtccaccaaccaggcc
aagcagtacaggttcgccctccaggagcgcctggacatggcacgggaaaccctcgcctcg
ctcaagggcatcgtggtggaaccggtcggggagggcctgctcgcagagtattgccggcag
cggggtgtttcggccatcgtcaagggactcaggtcttcctcggacttcgactacgagctg
cccatggccaccatgaaccggcagctcagcggcgttgaaacggtcttcctgcctgcggag
gcccattacctccacctttcttccaccctcatcaaagaggtggccggcctggggggaaat
gtgtccgactacgtgccccgctcggtgcagcggcggatgcttgcgggcgagtcgggcccc
ggccagcagccgagggggtag

DBGET integrated database retrieval system