KEGG   Arthrobacter sp. NyZ413: ABCW42_15750
Entry
ABCW42_15750      CDS       T11382                                 
Name
(GenBank) ankyrin repeat domain-containing protein
  KO
K06867  uncharacterized protein
Organism
artn  Arthrobacter sp. NyZ413
Brite
KEGG Orthology (KO) [BR:artn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ABCW42_15750
SSDB
Other DBs
NCBI-ProteinID: XQZ27460
LinkDB
Position
complement(3383594..3384007)
AA seq 137 aa
MSETNGADAETMSEDDEAIALAHTLFDAAREGNSELLRSYLNAGAPARMTNAAGDSLLML
AAYHGHAETVQLLLHHGADTNAANDRGQTPLAGAVFKGYSEVARVLIDAGADPDAGSPTA
REAARMFARTDILELLG
NT seq 414 nt   +upstreamnt  +downstreamnt
atgagcgagaccaacggcgccgatgccgagaccatgagcgaggatgacgaagccattgcc
ctggcgcacaccctgttcgacgccgcccgggaaggtaattccgaactgcttcgcagctac
ctcaatgccggcgcgcctgcccgaatgaccaatgccgccggggattcgctcctcatgctg
gccgcttatcacggccacgcggaaaccgttcagctgctgctccaccacggtgccgatacg
aacgcggccaacgatcggggccagacgccgttggccggagccgtcttcaagggctacagc
gaggtggcccgcgtcctgatcgacgccggggcggatcccgacgccggcagccccacagcg
cgcgaggccgcccggatgtttgcccgcacggacattctcgaattgctcgggtag

DBGET integrated database retrieval system