Arthrobacter sp. OVS8: PJ267_15495 Help Entry PJ267_15495       CDS       T10749                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism arto  Arthrobacter sp. OVS8 Brite KEGG Orthology (KO) [BR:arto00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:arto03032]     PJ267_15495    03036 Chromosome and associated proteins [BR:arto03036]     PJ267_15495    03400 DNA repair and recombination proteins [BR:arto03400]     PJ267_15495 DNA replication proteins [BR:arto03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PJ267_15495 Chromosome and associated proteins [BR:arto03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PJ267_15495 DNA repair and recombination proteins [BR:arto03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PJ267_15495 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WCI07970 LinkDB All DBs Position 3065555..3065842 Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVSKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaacttgttgcagaggtagcaggcaaggccggcaccagccag gcagccgtcaactccgtgctggatgcactgttcgaggtcttcgagacctctgtcgccgcg ggcgaaaagatcaccatcccgggctggctcgcagttgagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggcgagaccatccagatcgccgcgggccacagcgtcaag ctgaccgcaggctccaagctgaaggctgcggtctccaagaagaagtag

DBGET integrated database retrieval system