Arthrobacter sp. 7749: CGQ24_11280 Help Entry CGQ24_11280       CDS       T10551                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism artq  Arthrobacter sp. 7749 Pathway artq00998   Biosynthesis of various antibiotics artq01100   Metabolic pathways artq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:artq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGQ24_11280    00074 Mycolic acid biosynthesis     CGQ24_11280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGQ24_11280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Pro_sub2 Ag332 Motif Other DBs NCBI-ProteinID:  ASN39540 LinkDB All DBs Position 2453378..2453623 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLETEAVEMDKSFTEDLDIDSISMMTIVVNAEEKFDVKIPD EEVKNLKTVADAVNFIAAAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagagattctggccggcttggccgagatcgtcaacgaagagaccggt ctggagaccgaagctgttgaaatggacaagtccttcaccgaggatctggacatcgactcc atctcgatgatgaccatcgtcgtcaacgccgaagaaaagttcgacgtgaagatcccggac gaagaggtcaagaaccttaagaccgttgcagatgcagtgaacttcatcgctgctgcacag gcctaa

DBGET integrated database retrieval system