KEGG   Arthrobacter sp. 7749: CGQ24_16645
Entry
CGQ24_16645       CDS       T10551                                 
Name
(GenBank) dihydrofolate reductase
  KO
K26252  DtxR family transcriptional regulator, iron-dependent repressor
Organism
artq  Arthrobacter sp. 7749
Brite
KEGG Orthology (KO) [BR:artq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:artq03000]
    CGQ24_16645
Transcription factors [BR:artq03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    CGQ24_16645
SSDB
Motif
Pfam: Fe_dep_repr_C Fe_dep_repress MarR_2 HTH_24 DtxR FeoA HTH_Crp_2 HTH_1 DUF7343 Rrf2 MarR HemN_C HTH_AsnC-type HTH_11 TrmB
Other DBs
NCBI-ProteinID: ASN40477
LinkDB
Position
complement(3696658..3697377)
AA seq 239 aa
MSDLIDTTEMYLRTILELQEEGVVALRARIAERLGHSGPTVSQTVARMERDGLVIVSTDR
HLELTEQGSALATGVMRKHRLAERLLADVIGLEWEFVHEEACRWEHVMSERVEQRLFALL
GRPDVSPYGNPIPGLEALGGPGFAEIAVHVQNLDSALLDGNVGPVRVERLAETIQVEPEL
LVQLDEGGIRPGALVTLERAGEYVVVRVEGIEGALELPTEVSAHVFVRRLDDNGIVTLV
NT seq 720 nt   +upstreamnt  +downstreamnt
gtgtctgacctgatcgataccaccgaaatgtatttgcgcaccattcttgaactccaagaa
gagggcgttgttgccttgcgcgcacgtattgcggaacggcttggacattccgggccaacg
gtctcgcaaacggtggccaggatggaacgcgacgggctggttattgtcagtaccgatcgc
cacctggaactcaccgaacagggctctgccctcgccaccggcgtcatgcgcaagcaccgt
cttgccgagcgactactggccgacgtgatcgggcttgaatgggaattcgtccacgaggaa
gcctgccgctgggagcatgtgatgagcgaacgcgttgagcagcgactcttcgccttgctc
ggccgaccagatgtctccccgtatggaaacccgattccgggactcgaagccctcggcggt
cccggtttcgccgaaatcgccgtacatgttcagaatctcgattccgcactgttggatggc
aatgtaggacccgttcgagtcgagcgacttgccgagaccattcaggttgaacccgaactg
ctcgtacagcttgatgagggcggaattcgccctggtgccctagtcacgcttgaaagggcc
ggagaatacgtggtggtccgcgttgaagggattgaaggcgcgttggaacttccgaccgaa
gttagcgcccatgtatttgtccgtcgcttggatgataacggaattgtaactttggtataa

DBGET integrated database retrieval system