Arthrobacter sp. UKPF54-2: E7Y32_06340 Help Entry E7Y32_06340       CDS       T10403                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism artu  Arthrobacter sp. UKPF54-2 Brite KEGG Orthology (KO) [BR:artu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:artu03032]     E7Y32_06340    03036 Chromosome and associated proteins [BR:artu03036]     E7Y32_06340    03400 DNA repair and recombination proteins [BR:artu03400]     E7Y32_06340 DNA replication proteins [BR:artu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E7Y32_06340 Chromosome and associated proteins [BR:artu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E7Y32_06340 DNA repair and recombination proteins [BR:artu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E7Y32_06340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QDY89876 UniProt:  A0A5B8JFF6 LinkDB All DBs Position 1399643..1399930 Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaacttgttgcagaggtagctggcaaggccggcaccagccag gcagccgtcaactccgtgctcgatgcactgttcgaggttttcgagacctctgtcgccgcg ggcgagaagatcaccatccccggctggcttgccgtcgagcgcaccgaccgtgcagcccgc accggccgcaacccgcagaccggcgagaccatccagatcgccgctggccacagcgtcaag ctgaccgccggctccaagctgaaggctgcagtcgccaagaagaagtag

DBGET integrated database retrieval system