KEGG   Arachnia rubra: J5A65_13325
Entry
J5A65_13325       CDS       T07339                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
arub  Arachnia rubra
Pathway
arub00333  Prodigiosin biosynthesis
arub01100  Metabolic pathways
arub01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arub00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5A65_13325
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QUC07876
LinkDB
Position
complement(2943945..2946584)
AA seq 879 aa
MTGQMTCTTVRGGVVKLGEGGQLPARREQLGGKGASLDSLAAWGLPVPRGFCVTSGLLDR
GLDEEGRALIREAYRRLGSPVVAVRSSALLEDGESSSAAGVYETVLGVNTEEGLLTAITS
CLASGLSDRAEAYYGGTRESASMAVIVQEMVDARTSGVFFTVDPLAPESGESVVESSWGA
GEGVVQARVAVDRFRLDVKSGRTLRAEIGDKPDKIMIRPGEGPTTVAVSRDRRLEASLSE
EERKQLCMFARQVCERFAGPVDLEFCVGAEGIRLLQARRITALDALPDELSSREFSPYEV
DVIPSVRAGTMWSRMDIGEIFNGMMTPMGLGFARHYQYQVHVDCVRSTGIADGGRAELHM
GYLRGYVYLNISYTARLLQQSPASRNQAGFTERFRSEETAAETYSNPFGERPGAVESLRG
AAHWAFMTCRELVSMRARARRLDRWRFEALRSAEDEDLSKLSRYQLGRKLEEALAAFHTT
HVGYMPYYLNAAGVYQVLERISRAWLNETSVDELVNGVKSDMSALRTVRTAGDLAALARV
AQQIPDVARILRGESAPRRLAALSDSAEGRDFLASHVAQFLREHGTRGRQEMELSRPRWV
DDPSYVLTMLSAYLTQPGLLETVETHVSERRNPTNILATLPHRRAFILRAIVRAYTEFSR
LREVTRMPMVTAIWLVRRVVVECARRAVADGLLRSAEEAWLLDFEDFRRCLAGGLAWEKF
FSREAVERGREEHDRNLCGPEPPLTIIGTWNGSIPEKTSNSDGSDEALLTGLGTSAGIVE
GRARVIVDVASQAGEMQSGEVLVTTFTDASWTPLFAMAAGVVADTGSLLSHSSIVARELR
IPSVVNTRYGTSQIRTGDWVRVDGSQGTVRILGRDESQP
NT seq 2640 nt   +upstreamnt  +downstreamnt
gtgacggggcagatgacatgcaccacggttcgtgggggcgtcgtcaagctcggcgagggc
ggccagctgcccgcgcgtcgcgagcaattgggcggcaagggggcgagtcttgactcactc
gctgcctgggggctgcccgttccgcggggcttctgcgtcacaagtgggcttcttgaccga
gggcttgacgaggagggaagggcactcatccgcgaagcctaccgccgtctcgggagcccg
gttgtcgcagtgcgcagctctgctctgcttgaggatggggaatccagctctgcagcgggt
gtttatgagactgtcctgggggtgaacactgaggaggggctcctcacagcgattacgagc
tgccttgcctctggcctctcggacagggctgaagcctattacggtggcacccgagaatcg
gcgagtatggctgtgatcgtccaggaaatggtggatgcgcgcacctcaggagttttcttc
acggtggatcccctagcgcctgagagcggggagtcggtggtggagtcgagttggggtgcg
ggtgagggtgtcgtccaggcgcgtgtcgcagtcgacaggttccgacttgatgtgaagagc
ggaagaacgctgagggctgagataggggataagcctgacaagatcatgatccggcccggt
gaggggccgacaacggttgctgtctcccgggatcggcgtcttgaagcgagcctttctgag
gaggagaggaaacagttgtgcatgttcgcacggcaggtctgtgagcgatttgccggtcct
gtggatcttgaattctgtgtcggagcggaagggattcggcttctgcaggcacgtcgcatc
actgcgcttgacgcgttgcccgacgaactctcatcccgcgaattctcaccctatgaggtg
gatgtcatcccctcggtgcgtgccgggacaatgtggtcccggatggatatcggcgagatc
ttcaacgggatgatgactccgatgggcctcggatttgctaggcactaccagtaccaggtt
catgttgattgtgtgcgttccaccggaattgcggatggcggacgtgctgaattgcacatg
ggatatttgcgcgggtatgtgtatctcaacatctcttacaccgcacgactgcttcagcag
tcgcctgcttcacggaatcaagcgggtttcacagagcgtttccgcagcgaggagacggct
gcggagacatacagcaatccttttggggagcgtcccggagccgttgagtctctgagaggg
gcagctcattgggcgttcatgacatgtcgggaactcgtcagcatgcgcgctcgggcacga
cgtcttgatcggtggcggttcgaggcgcttcgctctgcggaggacgaggatctttccaag
ttgtctcggtatcagcttggaagaaaacttgaggaggcccttgcggcttttcacacgaca
catgtcgggtacatgccgtactacctcaacgcggctggtgtgtatcaggtgctcgaaagg
atcagtagagcctggctcaatgagacgtctgtggatgagcttgtcaatggtgtgaaatca
gacatgtccgcgttgcggaccgtgaggaccgccggggatcttgcggctctcgcgcgtgtg
gctcagcagattccagatgtcgcgcggattcttcggggtgaatctgccccccgacggctt
gcggccctctcagacagtgcggaagggcgtgacttcctcgcatcacatgttgcccaattc
ctccgagaacacggcacgcgcggacgccaggagatggagctctcacgtcctcgttgggtt
gatgatccgtcctatgtcctgacgatgctgtcggcctatctcacgcagcccggactcctt
gagacggtggaaactcacgtgtcagagcgacgaaatcccaccaacatattggcaactctg
ccgcatcgccgtgccttcattctcagagcgatcgtccgtgcatacaccgaattcagtcgg
ctcagggaagtgacgcgcatgccgatggtgacggcaatctggcttgtgcgtcgcgttgtc
gtcgaatgcgcccggcgtgcagtggcggatggactgctgcgttctgcggaggaagcgtgg
ctgctcgattttgaggatttccgacgctgcctggcaggcggactggcatgggagaagttc
ttttccagggaggcagttgaacggggacgtgaggagcatgaccgcaacctttgcgggcct
gagcctccgttgacgatcatcggcacctggaatggaagcatccccgagaagacctcgaac
tctgatgggagtgatgaagctctgctgaccggtttgggcacgagcgctgggatcgtcgaa
ggccgggcacgcgtcatcgtcgatgtcgcatcccaggctggagagatgcagtctggggag
gtcctggtcaccacattcacagatgcatcatggactccgctgtttgccatggccgcggga
gttgtggctgataccggttccctgctttcacactcgtctatcgtcgcgcgagagctgcgc
attccctccgtcgtgaatacccggtatggaacctcacagattcgcaccggtgattgggtg
cgtgtggatggctcccaaggcactgtgcggattctgggcagagacgaaagccagccgtga

DBGET integrated database retrieval system