Altererythrobacter rubellus: QQX03_03035 Help Entry QQX03_03035       CDS       T09134                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arue  Altererythrobacter rubellus Pathway arue01100   Metabolic pathways arue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QQX03_03035    00074 Mycolic acid biosynthesis     QQX03_03035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QQX03_03035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 LpxI_N Motif Other DBs NCBI-ProteinID:  WIW96098 UniProt:  A0A9Y2F5D4 LinkDB All DBs Position complement(615615..615857) Genome browser AA seq 80 aa AA seqDB search MDRAEVDTKIRSLIESFNKKGVEIADETTFANDLEFDSLTVMDFVAEIEDAFDIIISMNQ QAEIENFGQLIDAVTKLKDL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaccgtgctgaagtcgatacgaagatccgctcgttaattgaatcttttaacaaaaaa ggtgtcgagattgctgacgagacgacgtttgccaatgatctggagtttgacagtttgact gtcatggatttcgtggcagagatcgaagacgcattcgatatcatcatcagcatgaatcaa caggccgagatcgaaaatttcgggcagttgattgatgccgttaccaaacttaaggacttg taa

DBGET integrated database retrieval system