Agrobacterium rubi: G6M88_05520 Help Entry G6M88_05520       CDS       T08058                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism arui  Agrobacterium rubi Pathway arui00260   Glycine, serine and threonine metabolism arui01100   Metabolic pathways Module arui_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:arui00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     G6M88_05520 Enzymes [BR:arui01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      G6M88_05520     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      G6M88_05520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD DUF3666 Motif Other DBs NCBI-ProteinID:  QTF99889 UniProt:  A0AAE7UQR6 LinkDB All DBs Position 1:complement(1146180..1146494) Genome browser AA seq 104 aa AA seqDB search MLLIRCPYCEEERSELEFRWAGEARIARPENILAISDEAFAEYFFMRDNDKGMVFERWRH IHGCGRFFNAARHAVTDKIHLTYKAGEPKPDEATVLAGHEGAAR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgctgctgatccgttgtccttattgtgaagaagagcgttccgagctggaattccgctgg gcgggggaggcgcgtattgcgcgacccgaaaatatcttggccatttccgatgaagcgttc gccgaatatttcttcatgcgcgacaatgacaagggcatggtgttcgagcgctggcggcat attcatggctgcggacgtttcttcaatgcggcgcgccatgccgtgaccgacaagatacac ctgacttacaaggcaggcgagccgaagccggatgaggcgacggtgctggccggacatgaa ggagcagcccgatga

DBGET integrated database retrieval system