Acipenser ruthenus (sterlet): 117401619 Help Entry 117401619         CDS       T07327                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism arut  Acipenser ruthenus (sterlet) Pathway arut04137   Mitophagy - animal arut04140   Autophagy - animal arut04144   Endocytosis arut04145   Phagosome arut04148   Efferocytosis arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117401619    04145 Phagosome     117401619    04140 Autophagy - animal     117401619    04137 Mitophagy - animal     117401619    04148 Efferocytosis     117401619  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117401619  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arut04131]     117401619   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arut04147]     117401619    04031 GTP-binding proteins [BR:arut04031]     117401619 Membrane trafficking [BR:arut04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     117401619 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117401619   Exosomal proteins of other body fluids (saliva and urine)    117401619   Exosomal proteins of colorectal cancer cells    117401619   Exosomal proteins of bladder cancer cells    117401619 GTP-binding proteins [BR:arut04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     117401619 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW PduV-EutP nSTAND3 ATP_bind_1 AAA_22 NTPase_1 Septin AAA_7 AAA_16 AAA_5 AAA_24 ATPase_2 G-alpha NACHT SRPRB ABC_tran NB-ARC AAA_14 Tubulin-binding ATP-synt_ab Motif Other DBs NCBI-GeneID:  117401619 NCBI-ProteinID:  XP_033858275 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVLVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQAGPRDPENFPF VVLGNKIDLENRQVPLKRVQAWCQSKNNIPHFETSAKEAINVEQAFQTIARNALKQESEV ETYDFPDQIKLDRNDQPRASSEGCNC NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcctccagaaagaaggtgctcctgaaagtgattatcctgggagactcgggtgttgga aagacctctctcatgaaccagtatgtcaacaagaagttcagtaaccagtacaaagccaca atcggagcggacttcctgaccaaggaggtgctggtggacgacaggctggtcacaatgcag atctgggacacggctgggcaggagcgtttccagtctctgggcgttgcgttctatcgcggg gctgactgctgcgtgctggtgttcgacgtcacggctccgaacaccttcaagactctggac agctggagagacgagttcctgatccaggccgggccccgagacccagagaacttcccattc gtagtgctggggaacaagatcgacctggagaacagacaggtgccgttgaagcgtgttcag gcgtggtgtcagagcaagaacaacatcccgcacttcgagacgagcgccaaggaggcgatc aacgtggagcaggccttccagaccatcgccaggaacgcactgaaacaggaatctgaagtc gagacgtacgacttcccagatcagatcaaactggacagaaacgaccagccgagagcttcg agtgaggggtgcaactgctga

DBGET integrated database retrieval system