Acipenser ruthenus (sterlet): 117403924 Help Entry 117403924         CDS       T07327                                  Name (RefSeq) C-X-C motif chemokine 10-like   KO K12671   C-X-C motif chemokine 10 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04060   Cytokine-cytokine receptor interaction arut04620   Toll-like receptor signaling pathway arut04622   RIG-I-like receptor signaling pathway arut04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:arut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117403924  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117403924    04622 RIG-I-like receptor signaling pathway     117403924    04623 Cytosolic DNA-sensing pathway     117403924  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arut04052]     117403924    00536 Glycosaminoglycan binding proteins [BR:arut00536]     117403924 Cytokines and neuropeptides [BR:arut04052]  Cytokines   Chemokines    117403924 Glycosaminoglycan binding proteins [BR:arut00536]  Heparan sulfate / Heparin   Chemokines    117403924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  117403924 NCBI-ProteinID:  XP_034781074 LinkDB All DBs Position 1:109574590..109579193 Genome browser AA seq 95 aa AA seqDB search MNSTAVLFAVFLLFAAVEGSPLYNKGRCRCIGSSADFIHLKRIEKFEVIPASPMCQQIEI VVTMKDTAEERCMNPKSKQAQNIISNLLKKRSSQK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaactccacagccgtcctctttgctgtttttctcttgtttgcagctgttgaaggctcc ccactttacaacaagggccgttgccgctgcattgggagcagtgctgactttatacattta aaacgcattgagaagtttgaagtgataccagcatccccaatgtgtcagcagatagagatt gttgttacaatgaaggacactgcagaggaaaggtgcatgaatcccaagtcaaagcaggca caaaacatcatcagcaacttgctaaagaaaaggtcctcacagaagtaa

DBGET integrated database retrieval system