Acipenser ruthenus (sterlet): 117408799 Help Entry 117408799         CDS       T07327                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04060   Cytokine-cytokine receptor interaction arut04218   Cellular senescence arut04620   Toll-like receptor signaling pathway arut04621   NOD-like receptor signaling pathway arut04622   RIG-I-like receptor signaling pathway arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117408799  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     117408799  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117408799    04621 NOD-like receptor signaling pathway     117408799    04622 RIG-I-like receptor signaling pathway     117408799  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117408799  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arut04052]     117408799    00536 Glycosaminoglycan binding proteins [BR:arut00536]     117408799 Cytokines and neuropeptides [BR:arut04052]  Cytokines   Chemokines    117408799 Glycosaminoglycan binding proteins [BR:arut00536]  Heparan sulfate / Heparin   Chemokines    117408799 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF4789 Motif Other DBs NCBI-GeneID:  117408799 NCBI-ProteinID:  XP_033870003 LinkDB All DBs Position 2:complement(68749460..68751163) Genome browser AA seq 98 aa AA seqDB search MNSKTALAVVILCLAVAALSEGMSLKSIGLELRCQCIKKESRFIHPRQIQNVELFPSGPH CKDAEVIATLKSGDQICLEPTAQWVKIVIKKILESSRT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaactccaaaactgcattggccgtggtcattctctgcctggctgttgctgctctatct gaagggatgtctttgaaaagcattggactcgagctccgttgtcagtgcattaaaaaagaa tcgagattcatccatcccaggcagatccagaatgtagagctcttccccagtggaccgcac tgcaaggatgctgaagtcattgccactctgaaatccggtgatcagatttgcttggaacca actgcccagtgggtcaagatagttataaagaaaatcttggaaagctcccggacctga

DBGET integrated database retrieval system