Acipenser ruthenus (sterlet): 117409670 Help Entry 117409670         CDS       T07327                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04060   Cytokine-cytokine receptor interaction arut04218   Cellular senescence arut04620   Toll-like receptor signaling pathway arut04621   NOD-like receptor signaling pathway arut04622   RIG-I-like receptor signaling pathway arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117409670  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     117409670  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117409670    04621 NOD-like receptor signaling pathway     117409670    04622 RIG-I-like receptor signaling pathway     117409670  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117409670  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arut04052]     117409670    00536 Glycosaminoglycan binding proteins [BR:arut00536]     117409670 Cytokines and neuropeptides [BR:arut04052]  Cytokines   Chemokines    117409670 Glycosaminoglycan binding proteins [BR:arut00536]  Heparan sulfate / Heparin   Chemokines    117409670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF4789 Motif Other DBs NCBI-GeneID:  117409670 NCBI-ProteinID:  XP_033871876 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search METMNCKITGSVVILCLALAAVSEGVSLKSIGLELRCQCIKKESRFIHPRQIQNVELFPS GPHCKDAEVIATMKSGHKICLDPNAHWVKIVIKRILE NT seq 293 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatgaactgcaaaattacaggaagcgttgtcattctctgcctggctcttgct gctgtttctgaaggggtgtctttgaaaagcattggactcgagctccgttgtcagtgcatt aaaaaagaatccagattcatccatcccaggcagatccagaatgtagagctcttccccagt ggaccgcactgcaaggatgctgaagtcattgctactatgaaatctggtcataagatttgc ttggacccaaatgcccattgggtcaagatagttatcaaaagaatcttggaaag

DBGET integrated database retrieval system