Acipenser ruthenus (sterlet): 117412364 Help Entry 117412364         CDS       T07327                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism arut  Acipenser ruthenus (sterlet) Pathway arut04137   Mitophagy - animal arut04140   Autophagy - animal arut04144   Endocytosis arut04145   Phagosome arut04148   Efferocytosis arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117412364    04145 Phagosome     117412364    04140 Autophagy - animal     117412364    04137 Mitophagy - animal     117412364    04148 Efferocytosis     117412364  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117412364  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arut04131]     117412364   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arut04147]     117412364    04031 GTP-binding proteins [BR:arut04031]     117412364 Membrane trafficking [BR:arut04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     117412364 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117412364   Exosomal proteins of other body fluids (saliva and urine)    117412364   Exosomal proteins of colorectal cancer cells    117412364   Exosomal proteins of bladder cancer cells    117412364 GTP-binding proteins [BR:arut04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     117412364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NB-ARC NACHT AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  117412364 NCBI-ProteinID:  XP_034759654 LinkDB All DBs Position 21:1165283..1178021 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNERAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccagaaagaaagttttgctgaaagtgatcatcctgggagactctggtgtaggc aagacctccctcatgaaccagtatgtcaataagaagttcagtaaccagtacaaagccaca ataggagccgacttcctaacaaaggaggtgatggtggacgacaggctggtcacaatgcag atctgggacacagctggccaggagcggtttcagtcgctgggcgttgcgttctatcggggg gcagactgctgcgtgctggtgttcgatgtgacggctccaaacaccttcaagactctggac agctggagagacgagttcctgatacaggccagcccccgggacccagagaacttccccttc gtagtgctgggcaacaagattgacctggagaacagacaggtcaccacaaaaagggctcag gcgtggtgtcagagcaaaaacaatatcccgtacttcgaaaccagcgccaaggaggcaatc aatgtggagcaggctttccaaaccatcgccaggaacgcacttaaacaggagacagaagtg gagctgtacaatgagttcccagagccgatcaaactggacaagaacgagcgagcgaagcct tccgcggagagctgcagctgctga

DBGET integrated database retrieval system